PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011079408.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SAP
Protein Properties Length: 450aa    MW: 50024.3 Da    PI: 6.821
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011079408.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP683.33.2e-20814491454
             SAP   1 mssssssssseseegseggeggdassgesegpsssrqraanevwpePflealatqvaidasrslGrlaaasalanvfqvcstwravsrsdllwqr 95 
                     ms+sssssss+ ee     eggd ++ e  ++++sr r+  evwp Pf+ea+a++v+ das+++Gr+aaa+al+n+fqvcstwra+srs+llwq+
  XP_011079408.1   1 MSASSSSSSSSGEEV----EGGDGGGVEGPSSPRSRIRWGSEVWPAPFVEAVAVRVTADASTTVGRIAAAQALFNIFQVCSTWRAISRSELLWQN 91 
                     777777666644433....2333333233455667778********************************************************* PP

             SAP  96 ltrriWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsCrclalsdkylaaGfadGavrlfdletrlhvstflpqh 190
                     ltrriW++t+l r+tWr+eyiy+hrt+ nfr rr  y+tl+f p+ v+++n+ d l Cr+lals++++aaGf+dGav+lf+l    hvstf+pqh
  XP_011079408.1  92 LTRRIWNVTHLTRNTWRQEYIYHHRTSCNFRLRRCIYTTLHFIPT-VNNNNNDDGLACRRLALSNNHIAAGFSDGAVHLFHLPDGFHVSTFYPQH 185
                     ********************************************8.6777788****************************************** PP

             SAP 191 rdrlGrfsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGrafhiWdaeteelvfvGGs 285
                     rdrlGrfs+avsGi++sd r+vfatldGdih++ i+ + +a+ rra+lGdvvn Galvdf+G++rWwvGlyaGvpG+af+iW++ +eelv vGG+
  XP_011079408.1 186 RDRLGRFSSAVSGIILSDVRIVFATLDGDIHTTDIEDEDMAPLRRAHLGDVVNHGALVDFTGCDRWWVGLYAGVPGHAFRIWNSVSEELVSVGGT 280
                     *********************************************************************************************** PP

             SAP 286 ltdPeavmGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeerrGlivssldasneayvvvdsrGvatvrrvenleevcrf 380
                     ltdP++vmGWh+lteltel+Grvrvt+++ avaCt+l+++vfdl+nqg+vlreee+rr ++v+ +da+ne++++ d rGva+vr v nlee c f
  XP_011079408.1 281 LTDPQSVMGWHLLTELTELIGRVRVTGNNEAVACTRLKVIVFDLQNQGIVLREEETRRRIMVGLFDANNESALITDDRGVASVRLVANLEEKCWF 375
                     *********************************************************************************************** PP

             SAP 381 rvrg.aqrgvlgCvnggyalvyaggvlrvWeiekkegylyslrervgevnalvaddrhvavsssdgtihlldfga 454
                     r+rg   r+ lgCvn gy+l++++g +rv+eie+ + yly+lre +g++nal+ad+++va++ssdgtihl+ fga
  XP_011079408.1 376 RLRGrNLRRTLGCVNSGYGLICGAGEIRVYEIEQGQ-YLYNLREAIGHCNALIADEKYVAACSSDGTIHLWYFGA 449
                     ****99****************************76.************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.1280.506.8E-766135No hitNo description
SuperFamilySSF813832.62E-868116IPR001810F-box domain
SuperFamilySSF509782.2E-14145242IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.105.8E-11149235IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509782.2E-14304445IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.105.8E-11398445IPR015943WD40/YVTN repeat-like-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MSASSSSSSS SGEEVEGGDG GGVEGPSSPR SRIRWGSEVW PAPFVEAVAV RVTADASTTV  60
GRIAAAQALF NIFQVCSTWR AISRSELLWQ NLTRRIWNVT HLTRNTWRQE YIYHHRTSCN  120
FRLRRCIYTT LHFIPTVNNN NNDDGLACRR LALSNNHIAA GFSDGAVHLF HLPDGFHVST  180
FYPQHRDRLG RFSSAVSGII LSDVRIVFAT LDGDIHTTDI EDEDMAPLRR AHLGDVVNHG  240
ALVDFTGCDR WWVGLYAGVP GHAFRIWNSV SEELVSVGGT LTDPQSVMGW HLLTELTELI  300
GRVRVTGNNE AVACTRLKVI VFDLQNQGIV LREEETRRRI MVGLFDANNE SALITDDRGV  360
ASVRLVANLE EKCWFRLRGR NLRRTLGCVN SGYGLICGAG EIRVYEIEQG QYLYNLREAI  420
GHCNALIADE KYVAACSSDG TIHLWYFGAA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0305043e-56KJ030504.1 Sesamum indicum clone TilSSR_1705 microsatellite sesame_1705 sequence.
GenBankKJ0761483e-56KJ076148.1 Sesamum indicum clone TilSSR_47349 microsatellite Sesame_47349 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079408.10.0PREDICTED: transcriptional regulator STERILE APETALA-like
SwissprotQ9FKH11e-158SAP_ARATH; Transcriptional regulator STERILE APETALA
TrEMBLA0A022R2A40.0A0A022R2A4_ERYGU; Uncharacterized protein
STRINGSolyc05g041220.1.11e-175(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40992345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-149SAP family protein